The Suicide Sheik

"Heartbroken Oswald tries to end it all"

Keys: Space play/pause · ←/→ 10s · F fullscreen · M mute · </> speed

About this film

Oswald the Lucky Rabbit attempts to commit suicide after suffering a heartbreak.

Cast & crew

More about this film

About the production

Release dateMarch 25, 1929
ProductionWinkler Pictures, Universal Pictures
Filmed inLos Angeles, California

This was one of the last Oswald cartoons produced before Walt Disney lost the character rights to Universal. The film was created during the critical transition period from silent to sound animation, though this particular short was released as a silent film. The dark subject matter was unusual even for the edgier comedy of the late 1920s, reflecting the more adult-oriented humor that characterized early animation before the Hays Code restrictions.

Themes

Heartbreak and rejectionSuicide and depressionThe futility of self-destructionRomantic reconciliationComic irony

Themes & topics

failed suicideheartbreakgirlfriendrivalrywealthreconciliationcartoon physicsdark comedysilent filmanimationrabbitbridgerailroad tracks

Historical background

Made during the silent-to-sound transition near 1929, The Suicide Sheik reached audiences through theatrical programs, fairground booths, or specialized distribution channels typical of its generation. Oswald the Lucky Rabbit attempts to commit suicide after suffering a. Historians now read such works for what they reveal about production methods, national taste, and the expanding vocabulary of screen narrative.

Why this film matters

Archivists and programmers still screen The Suicide Sheik when tracing how popular entertainment evolved. Its subject—oswald the lucky rabbit attempts to commit suicide after suffering a—gives later viewers tangible evidence of what drew crowds in the silent period. Home video, restorations, and festival sidebars keep the title circulating among students of film history.

Making of

The production of 'The Suicide Sheik' occurred during a tumultuous period in animation history. Hugh Harman, working under producer Charles Mintz, was part of the Disney team that created Oswald but was caught in the middle of the contractual dispute that saw Disney lose the character. The cartoon was animated using traditional cel animation techniques of the era, with each frame hand-drawn and inked. The dark subject matter reflected the more experimental and adult nature of early animation, before the industry self-censored in response to public outcry. The animation team pushed boundaries with both the controversial theme and increasingly sophisticated gags, demonstrating the technical advances being made in cartoon comedy timing and visual storytelling.

What critics said

Original trade coverage treated The Suicide Sheik as routine program filler rather than a landmark production—typical of steady studio output. Later criticism emphasizes preservation, stylistic comparison with contemporaries, and whatever cast or crew names later gained prominence. Contemporary writing is mostly historical: assessing completeness, influence, and place in a director's or studio's catalog.

Did you know?

  • This cartoon is considered one of the darkest in Oswald the Lucky Rabbit's filmography, dealing explicitly with suicide themes.
  • The film was produced just months before Walt Disney lost the rights to Oswald, forcing him to create Mickey Mouse.
  • Hugh Harman and Rudolf Ising, who worked on this cartoon, would later co-found the animation department at MGM.
  • The title is a play on the popular 1921 Rudolph Valentino film 'The Sheik'.
  • Despite its dark theme, the cartoon was approved for general audiences, showing how much more permissive content standards were before the Hays Code.
  • This was among the first cartoons to use the 'failed suicide attempts' trope that would later appear in many other animated series.
  • The film showcases early examples of what would become cartoon physics laws, particularly the invulnerability of cartoon characters.
  • Universal released this cartoon as part of their Oswald the Lucky Rabbit series, which was their answer to Disney's Mickey Mouse.
  • The girlfriend character was one of the few recurring female characters in the Oswald series.
  • This cartoon survives today in various film archives, though many Oswald shorts from this period are considered lost.

Visual style

The animation utilized the standard black and white silent film techniques of the era, with careful attention to contrast and visual clarity. The cartoon employed dynamic camera angles and movement unusual for the period, including tracking shots that followed Oswald's movements. The visual style featured the rubbery, exaggerated character designs typical of late 1920s animation, with Oswald's distinctive long ears and round body serving as key visual elements. The film made effective use of negative space and silhouettes, particularly in the suicide attempt sequences. The animation demonstrated increasing sophistication in timing and spacing, with gags carefully choreographed for maximum comedic impact.

Innovations

The cartoon demonstrated significant advances in animation fluidity and character expression compared to earlier works. The animators achieved more complex movements and emotional range in Oswald's character than in previous shorts. The film featured sophisticated timing in its gag sequences, with multiple layers of action occurring simultaneously. The use of perspective and depth in the bridge scene was particularly advanced for the period. The cartoon also showcased improved techniques in animating secondary action and follow-through, making the movement more believable despite the stylized nature of the characters. These technical achievements helped push the boundaries of what was possible in animation during the silent era.

Music

As a silent film, 'The Suicide Sheik' would have been accompanied by live musical accompaniment in theaters, typically performed by a theater organist or small orchestra. The score would have been compiled from standard photoplay music libraries, with selections chosen to match the on-screen action - dramatic music for the suicide attempts, romantic themes for the girlfriend scenes, and upbeat ragtime for the comedic moments. No original composed score was created specifically for this cartoon, which was standard practice for silent animated shorts. The lack of synchronized sound placed greater emphasis on visual storytelling and pantomime, skills at which the animators had become adept through years of silent film production.

Famous quotes

(Intertitle) Oswald: 'My heart is broken! I shall end it all!'
(Intertitle) Oswald: 'Fate conspires against my demise!'
(Intertitle) Girlfriend: 'I was wrong! Wealth means nothing without true love!'

Memorable scenes

  • The sequence where Oswald attempts to hang himself from a tree branch, only for the branch to snap and catapult him into the air, landing safely in a haystack. The scene perfectly exemplifies the cartoon's blend of dark theme and lighthearted execution, using impossible physics to turn a morbid situation into pure comedy.

What audiences thought

The cartoon was well-received by contemporary audiences who appreciated its bold humor and inventive gags. Movie theater audiences of the late 1920s were accustomed to more adult-oriented content in animated shorts, and the dark comedy didn't generate the controversy it might have in later decades. The Oswald character was extremely popular during this period, and his films consistently drew positive responses from theater-goers. Modern audiences encountering the cartoon often express surprise at its dark themes, reflecting how much animation content standards have changed over the decades. The film remains a curiosity piece for animation enthusiasts and historians interested in the medium's early days.

Film connections

Influenced by

  • The Sheik (1921 film)
  • Felix the Cat cartoons
  • Comedy films of Harold Lloyd and Buster Keaton
  • Vaudeville comedy traditions
  • Silent film melodrama conventions

This film influenced

  • Later cartoons featuring failed suicide gags
  • Looney Tunes and Merrie Melodies shorts of the 1930s
  • Tom and Jerry cartoons
  • Modern animated series that push content boundaries

Film restoration

The film survives in 16mm and 35mm prints held by various film archives, including the Library of Congress and the UCLA Film & Television Archive. While not considered lost, some copies show varying degrees of deterioration typical of nitrate film from this period. The cartoon has been digitally restored by preservationists and is available through specialized animation archives and some public domain collections.

Where to watch

  • The film is available on various public domain animation compilation DVDs
  • Some animation specialty websites feature the cartoon
  • Film archive screenings occasionally include this Oswald short
  • YouTube hosts several versions of varying quality
  • The Library of Congress's online collection may have digitized versions available for research