Park Your Car

Park Your Car

"The Comedy of Two Families and Their First Automobile!"

Free to watch 1920 20 minutes United States

Directed by Alfred J. Goulding

Automobile cultureNeighborly competitionMarital relationshipsClass aspirationsUrban modernization

Keys: Space play/pause · ←/→ 10s · F fullscreen · M mute · </> speed

Plot

In this silent comedy short, two neighboring couples become competitive when they both purchase automobiles, leading to a series of hilarious mishaps and misunderstandings. The husbands, eager to impress their wives with their driving skills, engage in increasingly ridiculous attempts to outdo each other on the road. Their automotive adventures spiral into chaos as they struggle with parking, navigation, and the general operation of their new vehicles. The film culminates in a frantic chase scene through city streets where both couples' cars become entangled in a traffic jam of their own making. Ultimately, the neighbors learn that friendship is more valuable than their petty competition over their new status symbols.

About the Production

Release Date August 15, 1920
Box Office Box office figures not recorded for this short film
Production Hal Roach Studios
Filmed In Los Angeles, California, Hal Roach Studios lot

This was one of many comedy shorts produced during the golden age of silent comedy at Hal Roach Studios. The film was shot in just a few days, typical of the rapid production schedule of comedy shorts of this era. The automobiles used were likely provided by local dealerships for product placement, a common practice in early Hollywood films.

Themes & Topics

automobileneighborscompetitioncomedysilent filmshort filmhusband and wifedrivingparkingtrafficmishapsslapstick

Historical Background

Released in 1920, 'Park Your Car' emerged during a transformative period in American history. The post-World War I economic boom was creating a new middle class with disposable income, and automobile ownership was becoming a symbol of status and freedom. The film tapped into the national obsession with cars, as Ford's Model T had made automobile ownership accessible to average Americans. This was also the golden age of silent comedy, with studios like Hal Roach competing with Mack Sennett and others to produce the next big comedy stars. The film reflects the urbanization of America and the changing social dynamics as cities adapted to accommodate the growing number of automobiles.

Why This Film Matters

While not a landmark film, 'Park Your Car' represents the typical comedy short that entertained millions of Americans during the silent era. It captured the public's fascination with automobile culture at a time when cars were still novel and often problematic to operate. The film contributed to the normalization of car ownership in popular culture, helping to demystify the technology through comedy. It also exemplifies the working-class comedy that appealed to recent immigrants and urban audiences, featuring relatable characters in everyday situations. The film's preservation of early 20th-century urban landscapes provides valuable historical documentation of American cities during the automotive revolution.

Making Of

The production of 'Park Your Car' was typical of Hal Roach Studios' efficient comedy short factory system. Director Alfred J. Goulding was known for his ability to quickly set up and execute gags, often improvising on set. The automobiles featured in the film were probably loaned by manufacturers eager to promote their products to the growing market of car buyers. Harry 'Snub' Pollard, despite his short stature, was known for his athletic comedy and likely performed many of his own stunts. The film's urban setting allowed for real street filming, a common practice that added authenticity to the comedy. Child actor Sunshine Sammy Morrison, despite his young age, was already a seasoned performer from his work in the Our Gang series and would have been directed with the same professionalism as adult actors.

What Critics Said

Contemporary reviews of comedy shorts were rarely extensive, but trade publications like Variety and Motion Picture News generally praised Hal Roach productions for their consistent quality and entertainment value. Critics of the era noted Pollard's energetic performance and the film's timely subject matter. Modern silent film scholars recognize 'Park Your Car' as representative of the studio system comedy short, though it's not considered among the era's most innovative works. The film is valued today more for its historical significance than its artistic merit, serving as an example of the typical entertainment product of its time.

Did You Know?

  • Harry 'Snub' Pollard was a popular silent comedian who often played alongside Harold Lloyd in early films before getting his own series
  • Director Alfred J. Goulding was an Australian-born director who worked extensively with Harold Lloyd and other comedy greats
  • Sunshine Sammy Morrison was one of the original members of the Our Gang comedy series and was one of the first African-American child stars in Hollywood
  • The film was released during the height of America's automobile craze, when car ownership was rapidly expanding across the country
  • This was one of over 200 short films Pollard appeared in during his career
  • The title cards were likely created by H.M. Walker, who wrote intertitles for many Hal Roach productions
  • The film was shot on the same studio lot where Laurel and Hardy would later create their classic comedies
  • Automobiles in 1920 still required hand cranking to start, which likely provided physical comedy opportunities in the film
  • The film was distributed by Pathe Exchange, one of the major film distributors of the silent era
  • Marie Mosquini was a former Mack Sennett Bathing Beauty before becoming Pollard's regular leading lady
More film details Visual style, music, quotes, restoration, and more

Visual Style

The cinematography, typical of Hal Roach productions of the era, was straightforward and functional, designed primarily to clearly capture the physical comedy. The camera work would have been static for most scenes, with movement only when necessary to follow action sequences. The film likely used natural lighting for exterior scenes and basic studio lighting for interiors. The urban setting provided interesting backdrops, and the cinematography would have emphasized the scale of the automobiles relative to the actors and their surroundings.

Innovations

While not technically innovative, 'Park Your Car' utilized the standard film technology of 1920, likely shot on 35mm film with the equipment available at Hal Roach Studios. The film's technical aspects were competent but not groundbreaking, focusing on clear presentation of the comedy rather than cinematic experimentation. The production would have used the standard editing techniques of the era, including title cards for dialogue and exposition. The film represents the state of commercial filmmaking technology during the silent era's mature period.

Music

As a silent film, 'Park Your Car' would have been accompanied by live musical performance in theaters. The score would typically have been compiled from standard photoplay music libraries, with selections chosen to match the on-screen action. Upbeat, comedic pieces would accompany the slapstick sequences, while romantic themes would underscore scenes between the couples. Larger theaters might have had small orchestras, while smaller venues would have used a pianist or organist. The music would have been crucial in establishing pacing and emphasizing comedic moments.

Famous Quotes

Title card: 'His first automobile - and his last chance!'

Memorable Scenes

  • The chaotic parking scene where both neighbors attempt to parallel park their cars simultaneously, resulting in a traffic jam and physical comedy as they bump into each other and other vehicles

What Audiences Thought

Audiences in 1920 would have found great amusement in the automotive mishaps depicted, as many viewers were experiencing similar frustrations with their own new vehicles. The relatable premise of neighborly competition would have resonated with theatergoers of the era. Pollard's physical comedy and the film's fast pace would have provided the escapist entertainment that audiences sought after the hardships of World War I. The film likely performed well in the short film market, which was the primary format for comedy during this period before feature-length comedies became more common.

Film Connections

Influenced By

  • Mack Sennett comedies
  • Harold Lloyd films
  • Charlie Chaplin shorts
  • Buster Keaton comedies

This Film Influenced

  • Later Hal Roach comedy shorts
  • Laurel and Hardy automotive comedies
  • Three Stooges shorts featuring cars

Film Restoration

The preservation status of 'Park Your Car' is uncertain. Many Hal Roach shorts from this period have survived, but some remain lost or exist only in incomplete form. The film may exist in film archives or private collections, but a restored, widely accessible version may not be available. The Library of Congress and other film preservation organizations continue to locate and restore silent era shorts, so the film's status may change.

Where to Watch

  • Currently not widely available on streaming platforms
  • May be accessible through film archives or silent film specialty distributors
  • Potentially available in collections of Harry 'Snub' Pollard films
  • Could be screened at silent film festivals or special events
  • May exist in public domain collections if copyright has expired